PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AS_7C1FD879C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 355aa    MW: 38081.2 Da    PI: 7.826
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AS_7C1FD879C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.9e-1662109148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g W++eEd++l d++ ++G g+W++++++ g+ R +k+c++rw +yl
  Traes_6AS_7C1FD879C.1  62 KGLWSPEEDQRLRDYILKHGLGCWSAVPAKAGLQRNGKSCRLRWINYL 109
                            678*******************************************97 PP

2Myb_DNA-binding50.54.8e-16115160148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg +++eE++  +++ ++lG++ W+ Ia +++ gRt++++k++w++yl
  Traes_6AS_7C1FD879C.1 115 RGMFSQEEEDVVINLQAKLGNK-WSQIAMHLP-GRTDNEVKNYWNSYL 160
                            788*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4657109IPR017930Myb domain
SuperFamilySSF466899.54E-2959156IPR009057Homeodomain-like
SMARTSM007171.6E-1161111IPR001005SANT/Myb domain
PfamPF002492.9E-1462109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-2263116IPR009057Homeodomain-like
CDDcd001671.66E-1065109No hitNo description
PROSITE profilePS5129425.295110164IPR017930Myb domain
SMARTSM007171.7E-14114162IPR001005SANT/Myb domain
PfamPF002493.2E-14115160IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-25117164IPR009057Homeodomain-like
CDDcd001677.25E-12118160No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MEPGGRSPSA ATTSAAATAH ILVLWDRRGG ESLGGISEEG EGRRHRSMGC RSCDKPKMNY  60
RKGLWSPEED QRLRDYILKH GLGCWSAVPA KAGLQRNGKS CRLRWINYLR PGLKRGMFSQ  120
EEEDVVINLQ AKLGNKWSQI AMHLPGRTDN EVKNYWNSYL KKRVMQLGSN SSSNPASKNA  180
SPELLTSMSA TTELIMTSGG GGGGGSTATS THDHDANISS SGAISAAEPF VDQHEHQHHH  240
QQQAKNFVFA DWMPTAAVTP AGPESYSMSA HWPASTASSG NVTPSHGAFV GDQMSGSSYA  300
ALQHPHQHHH HQSAVTVAGA HASAGGMVAG GGYFDLLNMG DIYGGFSTTN DDLLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-25621644105C-Myb DNA-Binding Domain
1mse_C5e-25621644105C-Myb DNA-Binding Domain
1a5j_A5e-25621647108B-MYB
1gv2_A5e-25621644105MYB PROTO-ONCOGENE PROTEIN
1h8a_C8e-255616423128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686640.0AK368664.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2077L03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952152.11e-139PREDICTED: transcription factor LAF1-like
TrEMBLW5GEG10.0W5GEG1_WHEAT; Uncharacterized protein
STRINGMLOC_58869.11e-169(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122962735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-53myb domain protein 86
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]